PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00146g00719.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 415aa    MW: 46498.9 Da    PI: 7.5369
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00146g00719.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.5e-334498155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Peaxi162Scf00146g00719.1 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3841101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-314299IPR009057Homeodomain-like
SuperFamilySSF466898.96E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-244499IPR006447Myb domain, plants
PfamPF002492.5E-104697IPR001005SANT/Myb domain
PfamPF143795.9E-23144191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MYHHQHQNKS MHLSTRMSIP ERHMLLQGGN GNGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NLHGQANASG ANKTVAAAEV  120
DRISENSATF MSNPSIGTQP NKNIHISEAI QMQIEVQRRL HEQLEVQRHL QLKIEGQGKY  180
LQAVLEKAQE TLGRQNMGTV GLESAKVQLS ELVSKVSNQC LNSAYPHIEE LSGFHSRQTQ  240
ATQPADCSID SCLTSGEGTL RDNTIHNNQI GLRPFDFTPS IESKDIENIT RLQQTELRWC  300
DNLKENRNLF SAIHESRDNA YTAETNYKNL SMSIGLQEGK LNGSSNHSDG KFNGTDTDVK  360
HYQAANRNNS MTERKKSLED YKLSYFAPKL DLNMHDETDA ASSCKQFDLN GFSWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089281.10.0PREDICTED: uncharacterized protein LOC107032210 isoform X1
RefseqXP_015089282.10.0PREDICTED: uncharacterized protein LOC107032210 isoform X1
TrEMBLM1AFH40.0M1AFH4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000216530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-135G2-like family protein